PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03120g01001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 108aa    MW: 11881.1 Da    PI: 4.2201
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03120g01001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF369.2e-12347347
                              --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
                    SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                              ++++s r+  +s+  + ++KK + LS+LCd+eva++i s++ ++ 
  Peinf101Scf03120g01001.1  3 SKSESERKALLSRNVASLFKKVQKLSILCDVEVALLISSPDENMA 47
                              788999999999999*************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0069152IPR002100Transcription factor, MADS-box
PfamPF003191.7E-10446IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.437453IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-11567IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MASKSESERK ALLSRNVASL FKKVQKLSIL CDVEVALLIS SPDENMAKLA TFKMANVEEK  60
RKQLDEEDVQ PVEPPVAGDE SGTRPEPAEG ENNNAGEQKD DEHPEDSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB6DT653e-17B6DT65_PETHY; Type I MADS box transcription factor (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14805210
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-06MIKC_MADS family protein